PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H04157.1.p
Common NameEUGRSUZ_H04157, LOC104417578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 232aa    MW: 26080.1 Da    PI: 4.8559
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H04157.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47e-18550348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +WT+eEd ll+++++q+G g W+++++  g++R++k+c++rw++yl
  Eucgr.H04157.1.p  5 AWTEEEDHLLKRCIEQYGEGKWRRVPQLAGLNRCRKSCRLRWLNYL 50
                      7*******************************************97 PP

2Myb_DNA-binding52.41.2e-1656100147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg++T+eE +l+++++ +lG++ W++Ia +++ gRt++++k++w+ +
  Eucgr.H04157.1.p  56 RGSFTEEEVDLIIQLHSLLGNR-WSLIAGRLP-GRTANDVKNYWNCH 100
                       89********************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.65150IPR017930Myb domain
SMARTSM007172.2E-13252IPR001005SANT/Myb domain
SuperFamilySSF466896.97E-29597IPR009057Homeodomain-like
PfamPF002491.8E-16550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-23557IPR009057Homeodomain-like
CDDcd001671.34E-11550No hitNo description
PROSITE profilePS5129426.32851105IPR017930Myb domain
SMARTSM007172.2E-1655103IPR001005SANT/Myb domain
PfamPF002493.9E-155698IPR001005SANT/Myb domain
CDDcd001673.28E-1258101No hitNo description
Gene3DG3DSA:1.10.10.608.6E-2558105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MGGVAWTEEE DHLLKRCIEQ YGEGKWRRVP QLAGLNRCRK SCRLRWLNYL RPNIKRGSFT  60
EEEVDLIIQL HSLLGNRWSL IAGRLPGRTA NDVKNYWNCH LSKKLDPQQI SNHEDNDLNT  120
KDDIKILCPS QPRDFAASSG GWTQPTTVAL KAPSSAHGPM PEEIGTSPSP PPKLYADQDE  180
LNNSNPPFFE EDGHVLGDLG MDLQFDGSAG LMQSSNQWDW DDLISDLDLW G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-24610610109B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H04157.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027133.11e-172PREDICTED: transcription factor MYB113-like
SwissprotQ9FNV94e-53MY113_ARATH; Transcription factor MYB113
TrEMBLA0A059B6071e-172A0A059B607_EUCGR; Uncharacterized protein
STRINGGLYMA18G41520.12e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17352611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-54myb domain protein 113